Protein Info for MIT1002_02344 in Alteromonas macleodii MIT1002

Annotation: Putative N-acetyl-LL-diaminopimelate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 30 to 401 (372 residues), 217 bits, see alignment E=9.3e-68 PF00266: Aminotran_5" amino acids 69 to 202 (134 residues), 31.2 bits, see alignment E=2.3e-11 PF01041: DegT_DnrJ_EryC1" amino acids 71 to 189 (119 residues), 20.1 bits, see alignment E=6.9e-08 PF01053: Cys_Met_Meta_PP" amino acids 93 to 206 (114 residues), 36.7 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 87% identity to amc:MADE_01041)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>MIT1002_02344 Putative N-acetyl-LL-diaminopimelate aminotransferase (Alteromonas macleodii MIT1002)
MKFASRATAISPFLAMAYGEKATTLEQQGKDVIRLNLGEPDFGAPAAVLAAMKESLSAPD
FPYTSALGMPELREAIARFYKVKHGVAVSPSRVVVTAGASGALLLASAALVEPGDNVILG
DPSYPCNRRFLNAFGAEVTLVPTRSEDNFQLTAASVADNWKHNTKGVLIATPANPTGTVI
DAEELTKIGEYCKSKGGFLIVDEIYLDLSLSADLDVRNDTFASQSTLGTDTKLQTVLANA
QLEETVVVINSFSKYFGMTGWRLGWCVVPEAMTPIVEKLAQNLFICPSTLSQKAALACFT
PEALAQCEQNRHTLEKRASLVFSALENMGLGLDAKPDGAFYAYINIKHTGLSAIEFCDAL
LSQHHVALTPGNDFGEHNANHYVRLSFATSIERLEEGLSRLAEFVASLN