Protein Info for MIT1002_02329 in Alteromonas macleodii MIT1002

Annotation: Molybdenum cofactor biosynthesis protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 4 to 151 (148 residues), 199.8 bits, see alignment E=9.5e-64 PF01967: MoaC" amino acids 15 to 150 (136 residues), 186.2 bits, see alignment E=1.4e-59

Best Hits

Swiss-Prot: 55% identical to MOAC_SHEON: Cyclic pyranopterin monophosphate synthase (moaC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 97% identity to amc:MADE_01048)

MetaCyc: 54% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>MIT1002_02329 Molybdenum cofactor biosynthesis protein C (Alteromonas macleodii MIT1002)
MSTFSHLNAGGEANMVDVSDKDVTKREATAEGFLYVSEDVIRQISESKIAKGDVFAVARV
AGIQGAKRCADLIPLCHPLVLSKVDINFDIQADQNRIKATCYCKLSGKTGVEMEALTGVN
VALLTLFDMCKAIDPGMHMEGVRVLEKKGGKTGHWQSET