Protein Info for MIT1002_02326 in Alteromonas macleodii MIT1002

Annotation: Molybdate-binding periplasmic protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details PF13531: SBP_bac_11" amino acids 82 to 331 (250 residues), 127 bits, see alignment E=5e-41 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 87 to 176 (90 residues), 71.6 bits, see alignment E=4.5e-24

Best Hits

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>MIT1002_02326 Molybdate-binding periplasmic protein precursor (Alteromonas macleodii MIT1002)
MDAQKVMVFSLAMRLSSFVNLAMLVLASVSTCASVALGVTAFSSSVAQASSFEAANNTVN
EGSVISADKQNQSVNFKRDEKINVAVAANFAKPLKSIAEQFTELTGIEVAVTVSSSGTLY
AQIQHGASFDVFLSADRARPQALVDNNVVHHGNLVDYAKGKLAFVYAGELSSEASHETSG
KRNCEQIARSSTGDTTAQINVQLTDCLSKQLVQLMENPQNKVAIANPKLAPYGDAAQQTL
QNLSLWQQFLPHRVMGKNVLQTLQFYTTGSVKGAFVAYSLALDLPADLSSNLPSHFNSVV
NTKSADAVTVIVPVPETLYQPIIQSLVVNSKTVATLSPNLFEPLPIKNVTAPVDEPVHKG
DNETTRAFRLSGANGVSSPSLFVQYLMSQGVQQSLIEWGYEPTIASGVGN