Protein Info for MIT1002_02325 in Alteromonas macleodii MIT1002

Annotation: Molybdenum transport system permease protein ModB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 16 to 221 (206 residues), 217.3 bits, see alignment E=8.8e-69 PF00528: BPD_transp_1" amino acids 32 to 218 (187 residues), 68.4 bits, see alignment E=3.4e-23

Best Hits

Swiss-Prot: 49% identical to MODB_AZOVI: Molybdenum transport system permease protein ModB (modB) from Azotobacter vinelandii

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 86% identity to amc:MADE_01052)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MIT1002_02325 Molybdenum transport system permease protein ModB (Alteromonas macleodii MIT1002)
MLTEFFGASTLEAILLTFKLAFITSGLLLLIALPLAWFLAKWQSKAKPLVMSILALPLVL
PPTVLGFYLLIAFSPQSALGQGWQSLTGSNLAFSFEGLVLGSVIYSLPFALQPLYSGFSQ
LDNRYLDVAKTLGFSAFEAFIKIVLPLSKAPIVVALGLSFAHTIGEFGVVLMIGGNIPGE
TQVLSIALYEQVEALEYNSAHNLALALLIFSFVMLAALYRFNGVTRSDEAR