Protein Info for MIT1002_02303 in Alteromonas macleodii MIT1002

Annotation: Swarming motility protein SwrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1059 transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details amino acids 498 to 522 (25 residues), see Phobius details amino acids 558 to 577 (20 residues), see Phobius details amino acids 874 to 894 (21 residues), see Phobius details amino acids 901 to 919 (19 residues), see Phobius details amino acids 926 to 948 (23 residues), see Phobius details amino acids 976 to 995 (20 residues), see Phobius details amino acids 1007 to 1033 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 48 to 1033 (986 residues), 612 bits, see alignment E=2.9e-187 PF03176: MMPL" amino acids 336 to 527 (192 residues), 27.4 bits, see alignment E=2.4e-10 amino acids 829 to 1033 (205 residues), 28.5 bits, see alignment E=1.1e-10 PF02355: SecD_SecF_C" amino acids 366 to 525 (160 residues), 29.5 bits, see alignment E=7.4e-11 amino acids 861 to 1026 (166 residues), 29.3 bits, see alignment E=8.1e-11

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 96% identity to amc:MADE_01075)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1059 amino acids)

>MIT1002_02303 Swarming motility protein SwrC (Alteromonas macleodii MIT1002)
MSTPSHNANNSSETHTEKRQIGEPNQRETDITSQPHLSKIAGIGASLARFALNKPVTIGM
LFLSMLLFGIVSGRLLPLEKFPGIDIPEMVVQIPYPDATPVEIETMITRPVEEAVATMSG
IKRLRARSYDNMAEVIVEFDWDENLKAKSIEAREKIDAIRHELPDDIERIMVYKFNTNDM
PIFQLRVSSDRDLSNAYDLLERNLKRPLERVPGVSKVELYGTMKRQITIRLDPKKMAAYQ
IDGTRLEQQLQNANFSLTAGYMYNNGEKILVNPTGEFTDVNDFKNMWVTRSVRLSDIASV
TYELPQRNEGRHLDRTFAVGFNVFRESGSNLVEVSDAVMKVIEKAKEDPEFTGISLFVMD
DTAKSVTSSLSDLLNAGLLGALLSIIVLYLFLRQLTTTLIVVLSVPFSICITLGVMYLLG
YTLNILSLMGLMLAVGMLVDNAVVITESVFQERQQEGNIKRATQIGVNKVSLAVIAGTAT
TAIVFLPNIIGVKIDVTIFLEHVAVAICISLFASLFIAKTLIPLLTTKVKIPVVKTPQTP
SYIKGYGRALNWMLKHQGVTCVIALFILASTFVPMQVVTSDDEGNDNQERIWLNYHVTQN
FTLDEVEKTVNKMEAYLYENQERFHIKQVYTYFTAGHAVSGITLNDQLPVSVGKIKEDIR
ENMPSFVRARPSFQWDSGNGGGVRVTLLGESSETLLNISEQIIPILSTIEGLEDVKADTG
STRDEVQIRIDREKANRFGIQVNDVAKLISTALRGSNLRTFRYGDAGEVAVQLKFGSDIQ
ASLSELKNINIGFTQGQSVTLNMIADFTVVPQLSQINRNYRQTALAIGANLEGETTTEQA
RERIEKALANIELPTGYKWTLDGSFSRQDEANAVMQMNMLLALCMIYVVMAALFESLILP
TSVITSLLFSFTGVFWAFMVTGTSMSIMGMIGMLILMGIVVNNGIVLVDRINQLINEGLS
LYDAVIEGCMTRIRPILMTVATTVLGLIPLAMGSTRIGGDGPPYSPMAIAIIGGLVFSTL
TSLFLVPLAYVLLLKLRFKTQRLFKTSKARVATYIKIAN