Protein Info for MIT1002_02298 in Alteromonas macleodii MIT1002

Annotation: LamB/YcsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF03746: LamB_YcsF" amino acids 1 to 244 (244 residues), 289.1 bits, see alignment E=1.5e-90

Best Hits

Swiss-Prot: 48% identical to PXPA2_PSEPK: 5-oxoprolinase subunit A 2 (pxpA2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07160, UPF0271 protein (inferred from 81% identity to amc:MADE_01080)

Predicted SEED Role

"Lactam utilization protein LamB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>MIT1002_02298 LamB/YcsF family protein (Alteromonas macleodii MIT1002)
MKLNCDLGESFGAWSMPVEAAIMAEIDQANIACGFHAGDPLVMKQAILSAKQHDVVIGAH
PAYPDLQGFGRRSMAIAADELSAMIQYQVSALSGMAKVCGANVSYVKPHGALYNDMMKDT
AVMRTVMQSIAEINMQSLNSPLALMVQATSQNAAIKEAAQEWGLPLYFEAFSDRRYTDEG
LLQSRLIEGAVLSESDALLQAKQLISSGTVTTASGATLAIEADSLCVHGDTKGAVNIAKK
IRTFL