Protein Info for MIT1002_02261 in Alteromonas macleodii MIT1002

Annotation: rhombosortase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 136 to 152 (17 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details TIGR03902: rhombosortase" amino acids 32 to 183 (152 residues), 180.4 bits, see alignment E=1.1e-57 PF01694: Rhomboid" amino acids 45 to 187 (143 residues), 33.4 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to amc:MADE_02194)

Predicted SEED Role

"Membrane protein, Rhomboid family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>MIT1002_02261 rhombosortase (Alteromonas macleodii MIT1002)
MSLPFSLKYSAGPLFIALCSVVAFFFEPMSGNYLAYDRYAIQGLETWRIVSGNIVHTNGY
HLLLNLAGLALLWALHGEHYRIGLYLKVFVWCCLGTSVGLYFFSPDLIWYAGLSGALHGI
FAWGACVDIKEKMKSGWLLLIGLAIKVGYEQIDGSSEQVANLIDAKVAVDAHLFGALTGI
AIFLLMFITAKRK