Protein Info for MIT1002_02232 in Alteromonas macleodii MIT1002

Annotation: Molybdopterin molybdenumtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF03453: MoeA_N" amino acids 6 to 166 (161 residues), 157.7 bits, see alignment E=3e-50 TIGR00177: molybdenum cofactor synthesis domain" amino acids 175 to 311 (137 residues), 94.6 bits, see alignment E=2.9e-31 PF00994: MoCF_biosynth" amino acids 179 to 315 (137 residues), 87 bits, see alignment E=1.5e-28 PF03454: MoeA_C" amino acids 332 to 402 (71 residues), 62.2 bits, see alignment E=6.8e-21

Best Hits

Swiss-Prot: 40% identical to MOEA_HAEIN: Molybdopterin molybdenumtransferase (moeA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 82% identity to amc:MADE_02163)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MIT1002_02232 Molybdopterin molybdenumtransferase (Alteromonas macleodii MIT1002)
MSSKWLSLEEALTKALDAAKAINDVEQVSIFDANNRILAQDVTAHVDVPPWDNSAMDGYA
VNAEDLKHSGKLEVQGVITAGMSADEPLEKGKAFKIMTGAPVPANANAVVMVENTESHDG
AVLINKIPSAQENIRKKANDIASGDTLISKGTRLHAEHLMLLSSQGNSKVAVFRKLRVGV
VATGSELATPGEPCKSTQIFESNRVGVSSILSNENVELIDFGIVEDDEASLRKLFIEASE
RVDVMVSSGGVSVGDADYVKDIIAELGTIDFWKVAVKPGKPFALGKINNTLFCGLPGNPV
SSFVTAKLLVVPVIKKMQGQVQPHEPFFVNASITTPLKRRAGRRDFQRATMVRNNQGEWE
VTPFRSQSSGVMTSITSANCLMVVHEDISELKVGDTIPVIPLHF