Protein Info for MIT1002_02231 in Alteromonas macleodii MIT1002

Annotation: Phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00702: Hydrolase" amino acids 18 to 201 (184 residues), 115.2 bits, see alignment E=1.3e-36 PF12710: HAD" amino acids 22 to 197 (176 residues), 41.9 bits, see alignment E=3.8e-14 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 22 to 233 (212 residues), 217.1 bits, see alignment E=4.1e-68 PF13419: HAD_2" amino acids 23 to 206 (184 residues), 127.3 bits, see alignment E=1.8e-40 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 84 to 206 (123 residues), 40.8 bits, see alignment E=5.1e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 123 to 200 (78 residues), 40.6 bits, see alignment E=7e-14 PF13242: Hydrolase_like" amino acids 164 to 231 (68 residues), 47.9 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 55% identical to GPH_COLP3: Phosphoglycolate phosphatase (CPS_0261) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 77% identity to amc:MADE_02162)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>MIT1002_02231 Phosphoglycolate phosphatase (Alteromonas macleodii MIT1002)
MLCLSHELANQKFVMQEINTFFFDLDGTLVDSVPDLATALNQTLNDYQLPTYNEQTIRHW
VGNGARVLVERGLSGNAKIRHHYTSNEIDAALEKFLFYYRTLDTKSTVLYDGVFSTLHAL
KEQGFTLALITNKPSEFIEPILSSFSIFSLFSLTIGGDSLPEKKPSSLPLLHACEKLGIS
PSQCVMVGDSKNDIVAAKAANIKSIGLTYGYNYGESIAKYKPNWVFDDFEEILTFAS