Protein Info for MIT1002_02226 in Alteromonas macleodii MIT1002

Annotation: tRNA (mo5U34)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 13 to 330 (318 residues), 495.6 bits, E=2.2e-153
• PF08003: Methyltransf_9
  • amino acids 13 to 331 (319 residues), 493.7 bits, E=6e-152
• PF13489: Methyltransf_23
  • amino acids 126 to 280 (155 residues), 61.5 bits, E=2.6e-20
• PF13847: Methyltransf_31
  • amino acids 127 to 237 (111 residues), 51.1 bits, E=4.1e-17
• PF13649: Methyltransf_25
  • amino acids 131 to 229 (99 residues), 43.6 bits, E=1.2e-14
• PF08241: Methyltransf_11
  • amino acids 132 to 233 (102 residues), 45.5 bits, E=2.8e-15
• PF08242: Methyltransf_12
  • amino acids 132 to 231 (100 residues), 41.1 bits, E=7.6e-14

Best Hits

Swiss-Prot: 87% identical to CMOB_ALTMD: tRNA U34 carboxymethyltransferase (cmoB) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 87% identity to amc:MADE_02157)

MetaCyc: 57% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (332 amino acids)

>MIT1002_02226 tRNA (mo5U34)-methyltransferase (Alteromonas macleodii MIT1002)
MSKLEQTWFTDCYKSLIDSPLSHWLQTLPAQMETWQQTAKHGEFDKWCRLLSKLPTTSPS
CVDLASSVSIGTENDVDEYVQKQIEGLLKQFMPWRKGPFNLHGIHIDTEWRSDWKWDRVA
PHISSLKDRNVLDVGCGSGYHMWRMLGEGANNVIGIDPTQLFLIQFHAIKQFISKSSAPS
ENIHFLPMGIEDMQPLRAFDTVFSMGVLYHRKDPMAFLQQLKDQLRKGGELVLETLVVDG
DENTVLMAGERYAQMRNVWFLPSTAALSVWLGRLGFENIRVVDINHTTLDEQRATPWMET
QSLKDFLDPEDITRTIEGYPAPQRAVIVANKK