Protein Info for MIT1002_02225 in Alteromonas macleodii MIT1002

Annotation: tRNA (cmo5U34)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 5 to 242 (238 residues), 310.8 bits, see alignment E=3.4e-97 PF00891: Methyltransf_2" amino acids 49 to 167 (119 residues), 22.7 bits, see alignment E=1.7e-08 PF09243: Rsm22" amino acids 55 to 189 (135 residues), 28.4 bits, see alignment E=3.4e-10 PF13847: Methyltransf_31" amino acids 56 to 188 (133 residues), 30.5 bits, see alignment E=8.7e-11 PF13649: Methyltransf_25" amino acids 60 to 158 (99 residues), 51.1 bits, see alignment E=5.4e-17 PF08241: Methyltransf_11" amino acids 62 to 162 (101 residues), 39.2 bits, see alignment E=2.7e-13 PF08242: Methyltransf_12" amino acids 62 to 160 (99 residues), 40.9 bits, see alignment E=8.5e-14

Best Hits

Swiss-Prot: 86% identical to CMOA_ALTMD: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 86% identity to amc:MADE_02156)

MetaCyc: 53% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>MIT1002_02225 tRNA (cmo5U34)-methyltransferase (Alteromonas macleodii MIT1002)
MKKHDNIYAKALNKVDDFKFDESVVDVFPDMIQRSVPGYETIVHTIGELAKIAVTPNTVV
YDLGCSLGAASLSVARALPNDTCEIIGVDASEAMVERCKRVVQTFTLPNPIVIQHGFAQS
VEIKNASLVVMNFTLQFIPPADREALLKRIYDGLNPGGMLVLSEKIRHPTLTGNELLVDL
HHQFKRDNGYSELEVSQKRAALEKVMLTDTFNEHDTRLRKVGFTDVVMWYKCYNFTSMVA
IKG