Protein Info for MIT1002_02219 in Alteromonas macleodii MIT1002

Annotation: Phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 8 to 335 (328 residues), 492 bits, E=4.2e-152
• PF00586: AIRS
  • amino acids 61 to 165 (105 residues), 85 bits, E=5.2e-28
• PF02769: AIRS_C
  • amino acids 177 to 339 (163 residues), 143.3 bits, E=7.3e-46

Best Hits

Swiss-Prot: 97% identical to PUR5_ALTMD: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 97% identity to amc:MADE_02148)

MetaCyc: 71% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Protein Sequence (346 amino acids)

>MIT1002_02219 Phosphoribosylformylglycinamidine cyclo-ligase (Alteromonas macleodii MIT1002)
MSENKTSLSYKDAGVDIDAGNQLVERIKSVTKKTHRPEVKGNLGGFGALCELPTKYKKPL
LVSGTDGVGTKLRVAMDANRHDGVGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVA
ASVVTGIGAGCEQAGCALIGGETAEMPGMYHDGDYDIAGFCVGVVEADKVIDGTNVKPGQ
KLIALGSSGPHSNGYSLVRKIIEVSGADVNADLNGKPIIDQLLEPTRIYVKSVLALLEEV
QVSAISHITGGGFWENIPRVLPEDAKVVIDESTWEWPAIFSWLQENGNVTRHEMYRTFNC
GVGLVIVVDESDTDAALNILKQHGENAWVIGDIAAKDGEEQVEINA