Protein Info for MIT1002_02205 in Alteromonas macleodii MIT1002

Annotation: Phosphoribosylaminoimidazole-succinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 3 to 234 (232 residues), 263.2 bits, E=1.5e-82
• PF01259: SAICAR_synt
  • amino acids 7 to 232 (226 residues), 282.7 bits, E=1.3e-88

Best Hits

Swiss-Prot: 97% identical to PUR7_ALTMD: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 97% identity to amc:MADE_02134)

MetaCyc: 69% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (237 amino acids)

>MIT1002_02205 Phosphoribosylaminoimidazole-succinocarboxamide synthase (Alteromonas macleodii MIT1002)
MEKRDELYRGKAKTVYYTDDSDKLILHFRNDTSAFDGEKIEQLERKGEVNNKFNHFIMTK
LEEAGIATQVEALVSDTESLVKKLDMIPVECVVRNLSAGSLVRRLGVEEGKELNPPIFEF
FLKNDALHDPMVNDYHILSFGWATEAQIAEMKALTFKVNSVLKALFDDAGMLLVDYKLEF
GVDKDGNIVLGDEFTPDGCRLWDKETRKKMDKDRFRQGLGSVVETYIEVAERLGLSL