Protein Info for MIT1002_02180 in Alteromonas macleodii MIT1002

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 931 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details PF13491: FtsK_4TM" amino acids 9 to 179 (171 residues), 130.6 bits, see alignment E=1.3e-41 PF17854: FtsK_alpha" amino acids 437 to 537 (101 residues), 107.9 bits, see alignment E=6.7e-35 PF01580: FtsK_SpoIIIE" amino acids 545 to 758 (214 residues), 272.1 bits, see alignment E=8e-85 PF01935: DUF87" amino acids 570 to 621 (52 residues), 27.2 bits, see alignment 1e-09 PF09397: FtsK_gamma" amino acids 865 to 925 (61 residues), 89.2 bits, see alignment 2.9e-29

Best Hits

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (931 amino acids)

>MIT1002_02180 DNA translocase FtsK (Alteromonas macleodii MIT1002)
MARLTGVQRVWEAGMIIACVFAFFLLLALASFHPGDPGWSQAGLQLDVHNWVGATGAWVA
DLLLFSFGFLAYLLPFGSAFLGWFLFQHIKELDEFDYLTIGLRIIGGLLMALGATGIASI
NFDDIYNFSAGGFVGDVISSALVPYFNTAGTILLLLCFFCTGFTLLTGISWLTIIDRLGE
GTLWLGRKTLSAPQSLLAFEMPRLALANKSSNQSGDEGAELDITSMRAEPLASTAQTKPS
QTQKTTPSRSEPTFGIDDVDDEPPFYTYDGDKSAQSNPNDTVNAEEDDATSSADVDADET
KKSSFSLSGMRSAVTGSFKDKVGLGKSSQDDSVQSEDDSSQHEHKHQAQQSPHINFDDLE
EFDEDLPYETGSKPITSANNSAPSVEGSEPNTETLQSQTVETQGASQGANQAFTPAALGA
KRVKARAGELDPDLPPMPSFDLLERADKHENPLTPEEIEGISRLVEEKLADFNIEATVVG
VFPGPVITRFELDLAPGVKVSKISGLSKDLARAMSAISVRVVEVIPGKSVIGLELPNKKR
EMVRLSEVISCDTFQSNKSPLTMVLGADISGQPVVVDLAKMPHLLVAGTTGSGKSVGVNV
MILSLLYKSTPEDVRMIMIDPKMLELSVYEGIPHLLAEVVTDMKEAANALRWCVGEMERR
YRLMSALGVRNLKGYNAKVEEAIANGTPIKDPLWKNEESMDAEAPDLAKLPAIVVVVDEF
ADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRCAFQVSSK
IDSRTILDQQGAETLLGMGDMLYLPPGSPVPTRVHGAFVDDHEVHAVVADWQKRGEPEYI
DEILNGEATAEVLLPGEQPEGEDQEFDAFYDEAVAFVTETRRASVSSVQRKFRIGYNRAA
RLVEQMEMSGVVSAQGHNGNREVLAPPPHKE