Protein Info for MIT1002_02168 in Alteromonas macleodii MIT1002

Annotation: Sulfurtransferase TusD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03012: sulfur relay protein TusD/DsrE
  • amino acids 4 to 129 (126 residues), 130.7 bits, E=1.4e-42
• PF02635: DsrE
  • amino acids 5 to 129 (125 residues), 47.7 bits, E=8e-17

Best Hits

Swiss-Prot: 39% identical to TUSD_VIBVU: Sulfurtransferase TusD homolog (tusD) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 60% identity to alt:ambt_08425)

MetaCyc: 36% identical to sulfurtransferase complex subunit TusD (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (6/11 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Protein Sequence (129 amino acids)

>MIT1002_02168 Sulfurtransferase TusD (Alteromonas macleodii MIT1002)
MAEYSVLITSSPFQGDTALRALSFAQGVIDNGDVINNVFFYSEGVHHTNNLMLKTGDELF
VLDSWKTLATEHNMKLLVCITAAVKRGIVSELEAKENGLSQANLTAPFEQAGLGEFFTAL
HDCNRLVQF