Protein Info for MIT1002_02132 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details PF14715: FixP_N" amino acids 37 to 82 (46 residues), 81.4 bits, see alignment 4.6e-27 TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 115 to 316 (202 residues), 216.6 bits, see alignment E=2.2e-68 PF13442: Cytochrome_CBB3" amino acids 150 to 224 (75 residues), 44.3 bits, see alignment E=2.8e-15 amino acids 238 to 311 (74 residues), 38.8 bits, see alignment E=1.5e-13 PF00034: Cytochrom_C" amino acids 153 to 227 (75 residues), 31.3 bits, see alignment E=6.3e-11 amino acids 237 to 314 (78 residues), 26.7 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 91% identity to alt:ambt_08245)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MIT1002_02132 Cytochrome c oxidase subunit III (Alteromonas macleodii MIT1002)
MSMFWTIWISVITLGLIIGCYFLLRWTLANKTGVPEGESMGHKFDGIEELNNQLPRWWTI
MFYMTIVWGFLYLALYPGLGAFEGILGWKSSNQNIQSLEESAQARIDAKEQGYLVEYDRE
LDFAAEKFDPIFEAYAQVPVEELAKDPEANKVGQRLFLQNCSQCHGSDARGQNGGFPNLT
DNDWLYGGSGAKIVETLTLGRKAAMPAWLDAMGEDGIEEVVNYVLSLSGRDVDPQLAEAG
KARFAACAACHGMDGKGNQALGAPNLTDNIWLYGGSHRAVTETLTYGRNGVMPSFKKTLG
DDKIHVVAAYVYSLSND