Protein Info for MIT1002_02129 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 10 to 465 (456 residues), 756.1 bits, see alignment E=8.2e-232 PF00115: COX1" amino acids 14 to 444 (431 residues), 394.6 bits, see alignment E=3.1e-122

Best Hits

Swiss-Prot: 79% identical to CCON1_PSEST: Cbb3-type cytochrome c oxidase subunit CcoN1 (ccoN1) from Pseudomonas stutzeri

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to amc:MADE_02054)

MetaCyc: 78% identical to cbb3-1 cytochrome c oxidase subunit N (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>MIT1002_02129 hypothetical protein (Alteromonas macleodii MIT1002)
MSEISQAQPDYNYKVVRQFTIMTIVWGIIGMGLGVFIAAQLFAPMLNFDTPWLTFSRLRP
LHTNAVIFAFGGCALFATSYYIVQRTCQVRLFSDKLAAFTFWGWQAVIVLAVITLPMGLT
STKEYAELEWPIDILLALVWVAYIINFFGTLVIRKVSHIYVANWFLGAFMLTVAILHIGN
SMAIPVSFTKSYSLYAGAVDAMMQWWYGHNAVGFFLTAGFLGMMYYFVPKQAGRPVYSYR
LSIVHFWALISLYIWAGPHHLHYTALPDWTQSLGMVMSIILFVPSWGGMINGIMTLSGAW
HKLRTDPVLRFLIVSLSFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHSGALGWVAMVS
IGSIYHLIPVLFGQRAMYSTKLVNVHFWFATIGVVLYIVAMWMSGVLQGLMWRAVNADGT
LTYSFVESLEASKPFYVVRFIGGCFVVAGMLVMAYNTWKTIRAPKGSIAADPATQPA