Protein Info for MIT1002_02127 in Alteromonas macleodii MIT1002

Annotation: Bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00754: bacterioferritin
  • amino acids 1 to 155 (155 residues), 163.3 bits, E=2.2e-52
• PF00210: Ferritin
  • amino acids 9 to 144 (136 residues), 126.2 bits, E=4.9e-41

Best Hits

Swiss-Prot: 63% identical to BFR_SYNY3: Bacterioferritin (bfr) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03594, bacterioferritin (inferred from 98% identity to amc:MADE_02052)

MetaCyc: 48% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Protein Sequence (155 amino acids)

>MIT1002_02127 Bacterioferritin (Alteromonas macleodii MIT1002)
MKGNQAIINGLNELLSYELAAMDQYFIHSQMYLDWGLNKLYERIDHEFDDERGHATKLIE
RMLFLEGTPDMTKRTGFKVGKDVPEMLESDLRVEYEVDAKLREVIALCETEKDYVTRDML
IVLLDDTEMDHAHWLEQQLGLIKRLGIQNYLQSQM