Protein Info for MIT1002_02126 in Alteromonas macleodii MIT1002

Annotation: Bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00754: bacterioferritin
  • amino acids 1 to 155 (155 residues), 226.7 bits, E=6.8e-72
• PF00210: Ferritin
  • amino acids 9 to 137 (129 residues), 116.7 bits, E=4.1e-38

Best Hits

Swiss-Prot: 60% identical to BFR_AZOVI: Bacterioferritin (bfr) from Azotobacter vinelandii

KEGG orthology group: K03594, bacterioferritin (inferred from 92% identity to alt:ambt_08215)

MetaCyc: 56% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Protein Sequence (158 amino acids)

>MIT1002_02126 Bacterioferritin (Alteromonas macleodii MIT1002)
MQGDKQVVAKLNEVLTSELTSINQYFLHARMFKNWGFSELNEKNYKKSIKDMKQADDLIE
RILFLEGLPNLQALGKLYIGEDTVEMLSCDARFQKEQLPLLREAIALCEEKQDYVSRDLL
EDLLEYEEEHLDWIETQEYQIDAMGIENYLQAQVMGDD