Protein Info for MIT1002_02101 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxymuconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00013: 4-oxalocrotonate tautomerase family enzyme
  • amino acids 1 to 62 (62 residues), 93.6 bits, E=2.9e-31
• PF01361: Tautomerase
  • amino acids 2 to 58 (57 residues), 69.4 bits, E=9.6e-24

Best Hits

Swiss-Prot: 71% identical to 4OT_PSEUF: 2-hydroxymuconate tautomerase (dmpI) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 67% identity to bur:Bcep18194_B2957)

MetaCyc: 68% identical to 4-oxalocrotonate tautomerase subunit (Pseudomonas putida mt-2)
RXN-8529 [EC: 5.3.2.6]

Predicted SEED Role

"4-oxalocrotonate tautomerase (EC 5.3.2.-)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.2.-)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• catechol degradation to 2-hydroxypentadienoate II (4/4 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• protocatechuate degradation III (para-cleavage pathway) (4/5 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (4/6 steps found)
• 2,3-dihydroxybenzoate degradation (3/5 steps found)
• orthanilate degradation (3/5 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• 4-chloronitrobenzene degradation (3/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.- or 5.3.2.6

Protein Sequence (63 amino acids)

>MIT1002_02101 2-hydroxymuconate tautomerase (Alteromonas macleodii MIT1002)
MPIAQLYILEGRTDTQKENLISEVTDAMVRAIDAPKDRVRVIITEMPKTHFGIGGESASK
VKK