Protein Info for MIT1002_02101 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxymuconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 63 TIGR00013: 4-oxalocrotonate tautomerase family enzyme" amino acids 1 to 62 (62 residues), 93.6 bits, see alignment E=2.9e-31 PF01361: Tautomerase" amino acids 2 to 58 (57 residues), 69.4 bits, see alignment E=9.6e-24

Best Hits

Swiss-Prot: 71% identical to 4OT_PSEUF: 2-hydroxymuconate tautomerase (dmpI) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 67% identity to bur:Bcep18194_B2957)

MetaCyc: 68% identical to 4-oxalocrotonate tautomerase subunit (Pseudomonas putida mt-2)
RXN-8529 [EC: 5.3.2.6]

Predicted SEED Role

"4-oxalocrotonate tautomerase (EC 5.3.2.-)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.- or 5.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (63 amino acids)

>MIT1002_02101 2-hydroxymuconate tautomerase (Alteromonas macleodii MIT1002)
MPIAQLYILEGRTDTQKENLISEVTDAMVRAIDAPKDRVRVIITEMPKTHFGIGGESASK
VKK