Protein Info for MIT1002_02098 in Alteromonas macleodii MIT1002

Annotation: Acetaldehyde dehydrogenase 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03215: acetaldehyde dehydrogenase (acetylating)
  • amino acids 4 to 292 (289 residues), 473.2 bits, E=1.4e-146
• PF09290: AcetDehyd-dimer
  • amino acids 131 to 268 (138 residues), 214.7 bits, E=2.7e-68

Best Hits

Swiss-Prot: 79% identical to ACDH_PSEST: Acetaldehyde dehydrogenase (nahO) from Pseudomonas stutzeri

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 80% identity to pgv:SL003B_p0057)

MetaCyc: 78% identical to propanal dehydrogenase (Comamonas testosteroni)
RXN-12736 [EC: 1.2.1.87]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

• heterolactic fermentation (15/18 steps found)
• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• mixed acid fermentation (13/16 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• ethanol degradation I (2/2 steps found)
• (S)-propane-1,2-diol degradation (4/5 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• toluene degradation I (aerobic) (via o-cresol) (5/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
• 2-deoxy-D-ribose degradation I (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• L-threonine degradation IV (1/2 steps found)
• 2-aminoethylphosphonate degradation I (1/3 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
• sulfoacetaldehyde degradation IV (1/3 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
• p-cumate degradation (3/8 steps found)
• superpathway of purine deoxyribonucleosides degradation (2/7 steps found)
• triethylamine degradation (1/6 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• p-cymene degradation (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• mandelate degradation to acetyl-CoA (6/18 steps found)
• androstenedione degradation I (aerobic) (8/25 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of testosterone and androsterone degradation (8/28 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (9/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (10/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (10/47 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.10 or 1.2.1.87

Protein Sequence (303 amino acids)

>MIT1002_02098 Acetaldehyde dehydrogenase 4 (Alteromonas macleodii MIT1002)
MSKKLKAVIIGPGNIGTDLLMKIKRSDWIDLVWMVGIDPESSGLKRAAEMGIKVSSTGLD
GMLDKVIEDDIRIAFDATSAYVHAENSRKLNELGVIMIDLTPAAIGPFCIPPVNLKQHAE
KLEMNVNMVTCGGQATIPMVAAVSRVQDVEYGEIIATVSSRSVGPGTRQNIDEFTRTTSG
AVEKVGGAKKGKAIIIINPAEPPLMMRDTIHCLTKDSPDQEKIIESVHNMVNEVKKYVPG
YKLVNGPVFDGNKVSVFMEVKGLGDFLPEYAGNLDIMTAAALRTAEMFAEEAYDQTITLP
ARG