Protein Info for MIT1002_02096 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxymuconate semialdehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 29 to 262 (234 residues), 129 bits, E=3.7e-41
• PF12697: Abhydrolase_6
  • amino acids 32 to 265 (234 residues), 74.8 bits, E=2.5e-24
• PF12146: Hydrolase_4
  • amino acids 55 to 260 (206 residues), 47.3 bits, E=2.5e-16

Best Hits

Swiss-Prot: 74% identical to DMPD_PSEUF: 2-hydroxymuconate semialdehyde hydrolase (dmpD) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K05714, 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [EC: 3.7.1.-] (inferred from 72% identity to dar:Daro_3786)

MetaCyc: 66% identical to 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (Pseudomonas putida F1)
2-OH-6-OXOHEPTA-2-4-DIENOATE-HYDR-RXN [EC: 3.7.1.25]

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• catechol degradation to 2-hydroxypentadienoate I (2/2 steps found)
• toluene degradation I (aerobic) (via o-cresol) (5/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
• 2-nitrotoluene degradation (2/3 steps found)
• toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (2/4 steps found)
• toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (2/4 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• mandelate degradation to acetyl-CoA (6/18 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (9/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1,4-Dichlorobenzene degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Carbazole degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.25 or 3.7.1.9

Protein Sequence (276 amino acids)

>MIT1002_02096 2-hydroxymuconate semialdehyde hydrolase (Alteromonas macleodii MIT1002)
MSNVKNPEIGRTIDVNGIKTNLHDIGSGPSVMLIHGSGPGVTAWANWRLVMPELSKNYRV
VAPDMLGFGFTERPTNTQCNVDRWINHAIGILDALDIEQCDLVGNSFGGGIALALAIRHP
HRVRRLILMGSVGVPFTLTPGLDAVWGYSPSLTAMKSLLDIFAYDRSLVTDELAELRYEA
SIRPGFHEAFSSMFPAPRQRWIDALASEEADIRAIQHQTLIMHGREDQIIPLQTSQKLFE
WIPKSQLHVFGQCGHWTQIEHAARFSTLVSNFLAEI