Protein Info for MIT1002_02095 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxymuconic semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03216: 2-hydroxymuconic semialdehyde dehydrogenase
  • amino acids 4 to 486 (483 residues), 838 bits, E=1.1e-256
• PF00171: Aldedh
  • amino acids 13 to 482 (470 residues), 524.5 bits, E=1.1e-161

Best Hits

Swiss-Prot: 71% identical to DMPC_PSEUF: 2-hydroxymuconic semialdehyde dehydrogenase (dmpC) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K10217, aminomuconate-semialdehyde dehydrogenase [EC: 1.2.1.32] (inferred from 71% identity to avn:Avin_08730)

MetaCyc: 67% identical to 2-hydroxymuconate semialdehyde dehydrogenase subunit (Pseudomonas putida mt-2)
RXN-8527 [EC: 1.2.1.85]

Predicted SEED Role

"Putative 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase oxidoreductase protein (EC 1.2.1.60)" in subsystem Aromatic amino acid degradation (EC 1.2.1.60)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• catechol degradation to 2-hydroxypentadienoate II (4/4 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• protocatechuate degradation III (para-cleavage pathway) (4/5 steps found)
• 4-amino-3-hydroxybenzoate degradation (4/6 steps found)
• 2,3-dihydroxybenzoate degradation (3/5 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
• 2-aminophenol degradation (2/4 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (1/5 steps found)
• 2-nitrobenzoate degradation I (2/7 steps found)
• 4-chloronitrobenzene degradation (3/9 steps found)
• 4-nitrotoluene degradation II (3/9 steps found)
• 4-hydroxyphenylacetate degradation (2/8 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Toluene and xylene degradation
• Tryptophan metabolism
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.32 or 1.2.1.60 or 1.2.1.85

Protein Sequence (486 amino acids)

>MIT1002_02095 2-hydroxymuconic semialdehyde dehydrogenase (Alteromonas macleodii MIT1002)
MKEYKHFINGDYVGSQSGKTFENRCPVDNHLLGFVHEANEQDVDLAVKSAKTALKGPWGK
MTQSQRTELLNKVADRINERFDEFLEAECLDTGKPHSIARHIDIPRGAANFKAFAETLAN
HPTESFRLDTPDGNGAVNVGHRTPKGVIAVISPWNLPLLLMTWKVGPALACGNTVVVKPS
EETPATTTLLGDVMNECGVPAGVFNVVHGFGAGSAGEFLTTHPLVDAITFTGETSTGEAI
VKAAAVGLRSISMECGGKNPGIVFADCDIDKAIEGTMRSAFVNCGQVCLGTERVYVERPI
FDEFVKRLKEGVAKLKLGRPEDEDANFGPLVSLEHRNKVHSYYKLAVQEGATVEIGGGIP
DMGEALNDGAWIEPTVWTGLPDDARVIKEEIFGPCCHIRPFDTEEEVIALANDTDYGLAA
TIWSENSARSIRVAEQMETGLVWINSWFLRDLRTAFGGAKQSGVGREGGIHGLEFYTELK
NICLKL