Protein Info for MIT1002_02094 in Alteromonas macleodii MIT1002

Annotation: Metapyrocatechase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03211: catechol 2,3 dioxygenase
  • amino acids 4 to 307 (304 residues), 422.7 bits, E=4e-131
• PF22247: Diox-like_N
  • amino acids 66 to 124 (59 residues), 89.8 bits, E=9.8e-30
• PF00903: Glyoxalase
  • amino acids 150 to 266 (117 residues), 63.3 bits, E=3e-21

Best Hits

Swiss-Prot: 78% identical to XYLE_PSEAI: Metapyrocatechase (bztE) from Pseudomonas aeruginosa

KEGG orthology group: K00446, catechol 2,3-dioxygenase [EC: 1.13.11.2] (inferred from 71% identity to avn:Avin_08720)

MetaCyc: 78% identical to subunit of catechol 2,3-dioxygenase (Pseudomonas putida mt-2)
Catechol 2,3-dioxygenase. [EC: 1.13.11.2]

Predicted SEED Role

"Catechol 2,3-dioxygenase (EC 1.13.11.2)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.2)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• catechol degradation to 2-hydroxypentadienoate II (4/4 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• catechol degradation to 2-hydroxypentadienoate I (2/2 steps found)
• toluene degradation I (aerobic) (via o-cresol) (5/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
• 2-nitrotoluene degradation (2/3 steps found)
• toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (2/4 steps found)
• toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (2/4 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• mandelate degradation to acetyl-CoA (6/18 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (9/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.2

Protein Sequence (307 amino acids)

>MIT1002_02094 Metapyrocatechase (Alteromonas macleodii MIT1002)
MKKGIMRPGHVQIRVLDMEAALKHYVDLLGLIETDRDESGRVYLKAWTEVDKFSVVLREA
EEAGCDFMAFKVVDEEALLQLEKDLVKFGCDITHLEAGELKDCGRRVQFTSASGHCFELY
TDKKYTGKWGLNEVNPEAWPRNLTGMKAVRFDHCLFYGDALAETYDLFVNVLGFYLAEQV
LDPDGNRIAQFLSLSTKAHDIAFIMHEEKGKFHHASFYLETWEDILRAADLISMEDVPID
IGPTRHGLTHGKTIYFFDPSGNRTEVFAGGDYNYPDHKPVTWLSDDLGKAIFYHDRVLNE
RFLSVLT