Protein Info for MIT1002_02060 in Alteromonas macleodii MIT1002

Annotation: putative mercuric transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details PF02411: MerT" amino acids 4 to 115 (112 residues), 183.4 bits, see alignment E=6.4e-59

Best Hits

Swiss-Prot: 79% identical to MERT_SHEPU: Mercuric transport protein MerT (merT) from Shewanella putrefaciens

KEGG orthology group: K08363, mercuric ion transport protein (inferred from 100% identity to kko:Kkor_1272)

Predicted SEED Role

"Mercuric transport protein, MerT" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>MIT1002_02060 putative mercuric transport protein (Alteromonas macleodii MIT1002)
MAKNDTSLPLVGGIAAAIGAGLCCAGPLVLLLLGVSGSWIGNLTVLEPYRPIFILLVLVL
FSFAGWKVYRPIEECEPGTACAMPQVRKRRQIIFWVTAFIALILVTSNYWIIWFA