Protein Info for MIT1002_02059 in Alteromonas macleodii MIT1002

Annotation: Periplasmic mercury ion-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02052: mercuric transport protein periplasmic component" amino acids 1 to 91 (91 residues), 143.6 bits, see alignment E=1.1e-46 PF00403: HMA" amino acids 27 to 85 (59 residues), 58.2 bits, see alignment E=4.3e-20

Best Hits

Swiss-Prot: 70% identical to MERP_SHEPU: Mercuric transport protein periplasmic component (merP) from Shewanella putrefaciens

KEGG orthology group: K08364, periplasmic mercuric ion binding protein (inferred from 100% identity to kko:Kkor_1271)

Predicted SEED Role

"mercuric transport protein periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (91 amino acids)

>MIT1002_02059 Periplasmic mercury ion-binding protein (Alteromonas macleodii MIT1002)
MKKIALLSLLSILSLGAFAKQQTVMLEVPTMTCVTCPITVEKALQQVEGVTKAEVTFEDK
LAVVTFDDEKTTVEKLTEATKNAGYPSVVKQ