Protein Info for MIT1002_02057 in Alteromonas macleodii MIT1002

Annotation: Mercuric reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 PF00403: HMA" amino acids 4 to 63 (60 residues), 47.6 bits, see alignment 7.1e-16 PF07992: Pyr_redox_2" amino acids 84 to 402 (319 residues), 206.8 bits, see alignment E=2e-64 TIGR02053: mercury(II) reductase" amino acids 84 to 545 (462 residues), 553.3 bits, see alignment E=2.6e-170 PF12831: FAD_oxidored" amino acids 85 to 131 (47 residues), 32.1 bits, see alignment 3.2e-11 PF13738: Pyr_redox_3" amino acids 213 to 386 (174 residues), 36.3 bits, see alignment E=1.6e-12 PF00070: Pyr_redox" amino acids 256 to 326 (71 residues), 48.2 bits, see alignment E=5.3e-16 PF02852: Pyr_redox_dim" amino acids 421 to 527 (107 residues), 103.3 bits, see alignment E=3.5e-33

Best Hits

Swiss-Prot: 65% identical to MERA_SHEPU: Mercuric reductase (merA) from Shewanella putrefaciens

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 100% identity to kko:Kkor_1269)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.16.1.1 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>MIT1002_02057 Mercuric reductase (Alteromonas macleodii MIT1002)
MRKFSISGMTCERCPQQIEDALIVMPGVRNATVFYTKSSAVVEAESDVNEQTLINTIKAL
GYTAQPVALDGCDSEDVTDKKSLHVAIIGTGSAAFACAIKAVENGAQVTLVEAGDVIGGC
CVNVGCVPSKILLRAAQLAEQQRNNPFDGLENHEPSLDRSLLAKQQTARVEELRAAKYQH
ILDTNPALSLVQGYASFKDTHTLTIRNKDGYEQELVADRFLIASGSQPSIPPIPGLVDTP
YWTSTEALFETELPEHLLVIGSSVVAVELAQAYRRLGAEVTILARSTLLLREDPLLGEGL
TVAFEQEGIRVLEHTQASQVSYEDNKFILDTEQGEIRGDKLLVATGRAPNTGKLNLAAAG
VEKEANGAVTVGDQMRTSQSHIYAAGDCSNMPQLVYVAAAAGSRAGINMTGGEARLNLSA
MPAVIFTEPQVATVGLSEQEAHAQNIETESRVLPLENVPRALANFDSQGFIKLVVEAGSQ
RLIGAQVLAHDGGEIIQSAALAIHNHMTVDDLADQLFPYLTMVEGLKLCAQTFSKDIKEL
SCCAG