Protein Info for MIT1002_02047 in Alteromonas macleodii MIT1002

Annotation: Multidrug export protein MepA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 425 to 448 (24 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 27 to 413 (387 residues), 160 bits, see alignment E=4.1e-51 PF01554: MatE" amino acids 28 to 184 (157 residues), 75 bits, see alignment E=3e-25 amino acids 257 to 400 (144 residues), 54.9 bits, see alignment E=4.4e-19

Best Hits

KEGG orthology group: None (inferred from 46% identity to maq:Maqu_3521)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>MIT1002_02047 Multidrug export protein MepA (Alteromonas macleodii MIT1002)
MSLSTKDAILHNPLLGTFFKQAFLSLIGLVALTTASLVDGIFIGQYVGASGLAAVSLLLP
YITFLVALSLMLAIGGSVSIGTFMGKGDTKSASALFTQIIVVAVTLNIMLAVLSFVAEPF
LFWLLHIPSDVVPLTREYLSVIRWVFIFQFSTMVFYYLVRADGYTKLATIALALGAVTNI
LLDALLVAYLGYGIKGAAYATAAAQIVQLSVLLLYFADKNRAITFSTFNKPWRRIFRAVK
NGLSEFTNEISVGVLFLVINTLLVINSGSIGVAAYSVVNYFIFLSIMLSFGIADALHLLV
SYNRGASHTSRVNAFLLIALTTAFIAGLILTVCLLWFNHVFVALFIEPSQQQATKYAHTI
ILYVWPLFLVNGCNVLLSVFLTAIEKPLHSAFIALGRSILFPVSFLVLLSHFTPSPLVNE
GNDINISFLVALPAAEWVTFLLAVVLVYKHYYLKNTHM