Protein Info for MIT1002_02009 in Alteromonas macleodii MIT1002

Annotation: Fumarate hydratase class I, anaerobic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF05681: Fumerase" amino acids 11 to 285 (275 residues), 321.5 bits, see alignment E=4.4e-100 TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type" amino acids 12 to 285 (274 residues), 212.6 bits, see alignment E=6.4e-67 PF05683: Fumerase_C" amino acids 289 to 491 (203 residues), 302 bits, see alignment E=1.6e-94 TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type" amino acids 325 to 488 (164 residues), 165.4 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 98% identity to amc:MADE_01949)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>MIT1002_02009 Fumarate hydratase class I, anaerobic (Alteromonas macleodii MIT1002)
MTVIRQQDFIDSIEDALQFISYYHPLDYVKAVEEAYKKEKSQAAKDAMAQILINSRMSAE
GKRPLCQDTGIVTCFVKVGMGVTWDKTDMTVQEMVDEGTRRAYLNPDNPLRASIVADPAG
ARKNTKDNTPSVVHIDMVAGEKIEVMIAAKGGGSENKSKMVMLNPSDDIADWVVKTLPTM
GAGWCPPGMLGIGIGGTAEKAAVLAKESLMDPVDIQELIERGPQTTDEKLRLEIFDRVNK
LGIGAQGLGGLTTVVDVKIKSLPTHAASKPVAMIPNCAATRHAHFYLDGSGPAELTPPKL
EDWPEVTWEVSENTRRVNLDEVTKEDIQEWKVGETVLLSGKMLTGRDAAHKRIQTMMENG
EGLPEGVDLTNRFIYYVGPVDAVGDEVVGPAGPTTATRMDKFTDMMLEKTGLIGMIGKAE
RGPATVDSIAKHKAVYLMAVGGAAYLVSKAIKKSRVVAFEDLGMEAIYEFDVEDMPVTVA
VDSTGANAHKNGPAIWKAKIEELDASLSK