Protein Info for MIT1002_01989 in Alteromonas macleodii MIT1002

Annotation: Sensor histidine kinase YehU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details PF06580: His_kinase" amino acids 159 to 239 (81 residues), 94.6 bits, see alignment E=3.7e-31 PF02518: HATPase_c" amino acids 258 to 353 (96 residues), 34.7 bits, see alignment E=2.1e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to amc:MADE_01917)

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>MIT1002_01989 Sensor histidine kinase YehU (Alteromonas macleodii MIT1002)
MSRFQRVIESNERLFWTLHSAGWAGFAIIYYIGSFLHDVRPIWVFIIMLNAYAGWLLTIP
LRYIYRWARKQSPLNMIIIVIVSCYLIALLWAVVKNINYWEIYKHGYRPDEWYMYFTNTI
NSLIMVGCWSGVYFGIKNFQMLQKEKQNALKASTMAHQAHIKMLRYQLNPHFLFNTLNAI
STLILLKENDTAEAMVSRLSDFLRYSLDNDPIKRVPLGQEIKALRLYLEIEKVRFDDRLE
VLWDIDEGCESALVPSMILQPIIENSIKHAISKMENGGRIAITARTFGNDLLMDVADNGP
GADIKDGTLSRENGVGLANIKERLQSLYHRNFAFSIEHNQPSGVRVRIRIPYEVKDV