Protein Info for MIT1002_01988 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details PF06127: Mpo1-like" amino acids 1 to 148 (148 residues), 58.9 bits, see alignment E=2.3e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_01916)

Predicted SEED Role

"Putative PRS2 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>MIT1002_01988 hypothetical protein (Alteromonas macleodii MIT1002)
MRSIERLLMQYGESHQNKTNIIIHAIAVPSIYFVTIGLLWSLPVPYVIAQFDITWAHIIA
VPVLYYYFMLSGPIGAAMTLLTILCFGAVNTLDHFSISVWLFSLVLFVVMWILQFIGHHI
EGKKPSFFDDLRFLLVGPAWWWVHWLKRMNISY