Protein Info for MIT1002_01963 in Alteromonas macleodii MIT1002

Annotation: Ribose operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00356: LacI" amino acids 12 to 52 (41 residues), 59.4 bits, see alignment 4.8e-20 PF13407: Peripla_BP_4" amino acids 84 to 323 (240 residues), 43.5 bits, see alignment E=6.1e-15 PF00532: Peripla_BP_1" amino acids 84 to 335 (252 residues), 79.4 bits, see alignment E=6.6e-26 PF13377: Peripla_BP_3" amino acids 182 to 340 (159 residues), 124.8 bits, see alignment E=7.5e-40

Best Hits

KEGG orthology group: None (inferred from 95% identity to amc:MADE_01891)

Predicted SEED Role

"Transcriptional regulator of maltose utilization, LacI family" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MIT1002_01963 Ribose operon repressor (Alteromonas macleodii MIT1002)
MVFMKEKATSFDIAHLAGVSQSTVSRALNNSPLVNQETRDRVQRIARELNYKVDKNASNL
RKQKSSTIALLLFEDPTSDDSMINPFFLAMLGSITRACAQANYDLLVSFQNLDDDWHAEY
EDSNKADGIILLGYGDYTDYQNKVAQLESQGTHFVRWGAPDEAHPGVSIGCDNYQGGQSI
TSHLIGLGKTSFAFIGDNGDHAPEFKARFNGYFETLQSHGLDQSSVQRNAISTEDAGSEA
VKSLLQSGELPQAIVCASDLIAMGVLRALRQAKVNVPDDVAVVGYDNIAVSAYTTPSLTT
VQQNTKLAGELLVNTLLKAINNEDVQDYLMPADIIIRQSCGSE