Protein Info for MIT1002_01937 in Alteromonas macleodii MIT1002

Annotation: Glutathionyl-hydroquinone reductase YqjG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF13409: GST_N_2" amino acids 56 to 150 (95 residues), 46.2 bits, see alignment E=1.2e-15 PF14497: GST_C_3" amino acids 182 to 278 (97 residues), 28.7 bits, see alignment E=2.6e-10 PF00043: GST_C" amino acids 188 to 272 (85 residues), 39.1 bits, see alignment E=1.5e-13 PF13410: GST_C_2" amino acids 196 to 268 (73 residues), 60.2 bits, see alignment E=3.3e-20

Best Hits

Swiss-Prot: 61% identical to YQJG_ECOLI: Glutathionyl-hydroquinone reductase YqjG (yqjG) from Escherichia coli (strain K12)

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 89% identity to amc:MADE_01866)

MetaCyc: 61% identical to glutathionyl-hydroquinone reductase YqjG (Escherichia coli K-12 substr. MG1655)
RXN0-7010 [EC: 1.8.5.7]

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.8.5.7 or 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>MIT1002_01937 Glutathionyl-hydroquinone reductase YqjG (Alteromonas macleodii MIT1002)
MGLLIDGKWQDKWYDTSKNGGKFERQASKFRDKVSNEDGSTFPAESDRYHLYVSLACPWA
HRALIFRKLKGLEAHIDVSVVHPEMLDQGWEFKDYPGSTGDKLYNFDYAHQIYTKAEPEI
TTRVTVPILWDKRTETIVNNESAEIIRIFNSGFNSLTNNEDDYYPNAQREEIDAINNMVY
HDINNGVYKAGFATTQEAYEEAVTALFCALDRVEERLSKQRYLVGSKITEADWRLFTTLI
RFDAVYHGHFKCNKKQIADYPNIYGYMKELYQVPGVAETVNFDHIKRHYYYSHTMINPTQ
VIPVGPEQDLMSPHGRDKVGR