Protein Info for MIT1002_01933 in Alteromonas macleodii MIT1002

Annotation: Ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 38 to 466 (429 residues), 596.5 bits, see alignment E=3.5e-183 PF00919: UPF0004" amino acids 39 to 129 (91 residues), 76.2 bits, see alignment E=2.6e-25 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 39 to 466 (428 residues), 344.3 bits, see alignment E=9.7e-107 PF04055: Radical_SAM" amino acids 174 to 352 (179 residues), 95.6 bits, see alignment E=5.9e-31 PF18693: TRAM_2" amino acids 408 to 468 (61 residues), 59.8 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 96% identical to RIMO_ALTMD: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 96% identity to amc:MADE_01861)

MetaCyc: 76% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>MIT1002_01933 Ribosomal protein S12 methylthiotransferase RimO (Alteromonas macleodii MIT1002)
MTVETFNPNKVVNKTTTLEMPVKVLSDNKPSQQSNGSRIGFVSLGCPKNLVDSERILTQL
RTEGYDVVPTYNDADLVIVNTCGFIDAAVEESLDTIGEALKENGKVIVTGCLGVKEDEIR
ELHPNVLAITGPHAYETVVEQVHDHLPKPQHNPFEDLIPDHGVKLTPRHYAYLKISEGCN
HRCTFCIIPSMRGDLVSRPVGNVLDEAKRLKDAGVKELLVISQDTSAYGVDVKHRTGFWN
GMPVKAHMQQLCEKLGEMGIWVRLHYVYPYPHVDDLIPLMNEGKILPYLDIPFQHANKRI
LKLMKRPGSAERVLERVKKWREQCPSLVIRSTFIVGFPGETEEEFEELLDFLREAQLDRV
GAFAYSPVEGARANDLPDPVPEEVKQARLARFMEVQGEISAARLQARIGNEYQVVIDSVD
AEGAVGRTYADAPEVDGLVHLNGVYDVKPGDRVWAEVIHANEHDVWAVLSEDQDEEDEGT
DPAL