Protein Info for MIT1002_01927 in Alteromonas macleodii MIT1002

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 12 to 580 (569 residues), 745.6 bits, see alignment E=1.8e-228 PF00664: ABC_membrane" amino acids 28 to 289 (262 residues), 183.2 bits, see alignment E=8.6e-58 PF00005: ABC_tran" amino acids 357 to 507 (151 residues), 117.2 bits, see alignment E=8.7e-38

Best Hits

Swiss-Prot: 68% identical to MSBA_PSEA6: Lipid A export ATP-binding/permease protein MsbA (msbA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 85% identity to alt:ambt_07480)

MetaCyc: 54% identical to ATP-binding lipopolysaccharide transport protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-236 [EC: 7.5.2.6]; 7.5.2.6 [EC: 7.5.2.6]

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>MIT1002_01927 Lipid A export ATP-binding/permease protein MsbA (Alteromonas macleodii MIT1002)
MQQADNSDYQIKRFLQYLKAYKVPFVFAIIGMIGYSAVDTFVFSQLQPMIDESLGKNDHD
YLRLAAYAIVPLFLLRGVFNFLGSYTLSWIGAQVVMRMRQQLFEKYIHLPVAFHDNHAVG
GLISKVTYDTEQVANASGKALLTLVREGALVIGLLCVMFYYSWQLSLIFLLIGPIVAVIV
SVVSKRFRVVSKNIQQSMGNLTSSVEQAVKGHKVVIMFGGQEIEQKRFEQKNNHNRQQSM
KLNVTSILSVSSIQVIASIALAVVLFIASTPGMLEKLTAGVFINVVFCMVMLLKPLKQLT
TINNQFQKGMAACASIFEILDEADEEDKGKTKVERATGKIEFDDVTFSYPGKQTPALSNV
SFIANPGQSIALVGRSGSGKSTISSLLTRFYVPQEGEIRLDDTALNDIDLKDLRAQFAVV
SQNVTLFNDTIANNIAYGARQNVSRKDIENAAKMAHVEEFLSNLPEGLDTVIGENGLMLS
GGQRQRIAIARAILAEAPILILDEATSALDTESERLIQDALETLQKRCTSIVVAHRLSTI
ENADCIMVVEQGRIIEKGKHNELLEKGGHYAQLHALQFGETK