Protein Info for MIT1002_01918 in Alteromonas macleodii MIT1002

Annotation: Cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 5 to 106 (102 residues), 61.6 bits, E=5.8e-21
• PF08211: dCMP_cyt_deam_2
  • amino acids 6 to 78 (73 residues), 38 bits, E=1.8e-13
• TIGR01354: cytidine deaminase
  • amino acids 8 to 132 (125 residues), 145.3 bits, E=5.7e-47

Best Hits

Swiss-Prot: 41% identical to CDD_DICDI: Probable cytidine deaminase (cda) from Dictyostelium discoideum

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 95% identity to amc:MADE_01844)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• pyrimidine ribonucleosides degradation (1/2 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• pyrimidine deoxyribonucleosides degradation (1/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
• superpathway of pyrimidine ribonucleosides degradation (1/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Protein Sequence (135 amino acids)

>MIT1002_01918 Cytidine deaminase (Alteromonas macleodii MIT1002)
MKKNNLEQLSQLAFDAQKNSHSPYSNFKVGAAVLTPSGETFSGCNVESAAFPLGQCAEAT
AIGNMVTQGQKRISHIVIASPNDEFCFPCGGCRQKIAEFAPDETPVTMVSQNGETFETTI
GELLPNAFRAHDLDK