Protein Info for MIT1002_01852 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA large subunit methyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH
  • amino acids 20 to 175 (156 residues), 248.9 bits, E=9.1e-79
• PF02590: SPOUT_MTase
  • amino acids 21 to 173 (153 residues), 154.6 bits, E=1.1e-49

Best Hits

Swiss-Prot: 81% identical to RLMH_PSEA6: Ribosomal RNA large subunit methyltransferase H (rlmH) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00783, hypothetical protein (inferred from 94% identity to alt:ambt_09540)

MetaCyc: 75% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.177

Protein Sequence (175 amino acids)

>MIT1002_01852 Ribosomal RNA large subunit methyltransferase H (Alteromonas macleodii MIT1002)
MYGLYCISEILIPAVRVKEVRIQIVAVGTKMPSWVSTGVDEFIRRFPSDMPVSFTEIPAG
KRGKNADIKRILEKEGEQMLAAIPKGNRIVTLEVTGKPWDTPTLAKQLDNWKMDGRDVSL
LIGGPEGLAPECIAASEQKWSLSALTLPHPLVRIILTESLYRAWSVTQNHPYHRE