Protein Info for MIT1002_01850 in Alteromonas macleodii MIT1002

Annotation: Rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 20 to 366 (347 residues), 438.5 bits, see alignment E=9.4e-136 PF01098: FTSW_RODA_SPOVE" amino acids 23 to 367 (345 residues), 357.9 bits, see alignment E=2.8e-111

Best Hits

Swiss-Prot: 56% identical to RODA_ECOLI: Peptidoglycan glycosyltransferase MrdB (mrdB) from Escherichia coli (strain K12)

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 84% identity to alt:ambt_09550)

MetaCyc: 56% identical to peptidoglycan glycosyltransferase MrdB (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>MIT1002_01850 Rod shape-determining protein RodA (Alteromonas macleodii MIT1002)
MKRTTINPNKISFLQRIHIDGWLLVGLLVLSCVGLFTLYSASGQDMEQMERQFIRLGFSF
IVMFGLAQAPLGVFRFFSTYAYGAGLLMLIAVLLFGDMGKGAQRWLDLGFIRFQPSELMK
LAVPMMVAWYISKFTMPPRTTHIIVGFGLVVVPTILIAKQPDLGTSLLIASSGIFAIFLA
GMSWRLISVVGGLIGAFAPVMWFFLMKDYQKQRVLTFLNPESDPLGSGYHIIQSKIAIGS
GGVDGKGWLHGTQSQLEFLPERHTDFIFSVFSEEFGLTGVMCLMAIYIFIIMRGLIISSR
AQDAYAKLLGGSITLTFFVYVFVNMGMVSGLLPVVGVPLPLVSFGGTSMVTLMAGFGILM
AIATQKRLMSR