Protein Info for MIT1002_01840 in Alteromonas macleodii MIT1002

Annotation: Protease 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 613 (598 residues), 602.5 bits, see alignment E=7.4e-185 PF01343: Peptidase_S49" amino acids 139 to 297 (159 residues), 94 bits, see alignment E=4.9e-31 amino acids 396 to 546 (151 residues), 165.2 bits, see alignment E=5.8e-53 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 333 to 544 (212 residues), 175.2 bits, see alignment E=1.4e-55

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 92% identity to amc:MADE_01643)

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>MIT1002_01840 Protease 4 (Alteromonas macleodii MIT1002)
MAAKGNWTKSLFIGLWTVLNFTRKLFFNLIFIVIFVGLIIAITGQDDEQFTVNKDSALFL
TLNGKLVIEKESIDPFEQFLQESLGSEPENPEVLVRDVVKVLENAQKDRRIKALVLDLQG
LTGGGLDKLRTVANAIDAFKESEKPVYAIGDYFSQDQYYLAAHADSIYLNPMGGLMFEGY
GRYGMYFKDMLEKLKVTTHIFRVGTYKSAVEPIMRNDMSEEAKEAEKQWLDGYWAQYKAD
VAAARGIDEANFDETLEGLLAKFEAAGGDFAQYALENNWVDALKTREEVRLELTELVGED
ENNHGVNLTSFNTYLKVVNPPMPVIESDMDKVAIVVAKGTILDGNQKAGTIGGDSTARLL
RKARLDDNVKAVVLQIDSPGGSAFASEIIRQEVLQLQQAGKPVIASMSTYAASGGYWIAA
STDRIIASPSTITGSIGVFGMFMTYENSLDYLGIHSDGVGSTELAGFSTVRPLAPEFGQI
LQRNVENTYGNFLSLVSNARGMSVEEVDSVAQGRVWIGEDAIELGLVDQLGTVDDAVVAA
AELAELENYDTFYVQRTLSAQEIFWKEFFGQAMTFVGKWQFAHADSALVNEFKRVLKEFS
LVNQLNDPKGTYVLCLPCDVK