Protein Info for MIT1002_01815 in Alteromonas macleodii MIT1002

Annotation: Phosphoenolpyruvate synthase regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF03618: Kinase-PPPase" amino acids 5 to 260 (256 residues), 261 bits, see alignment E=6.9e-82

Best Hits

Swiss-Prot: 98% identical to PSRP_ALTMD: Putative phosphoenolpyruvate synthase regulatory protein (MADE_1008595) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K09773, hypothetical protein (inferred from 98% identity to amc:MADE_02383)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>MIT1002_01815 Phosphoenolpyruvate synthase regulatory protein (Alteromonas macleodii MIT1002)
MRTAFYISDGTAITAEVFGHALLSLFPVSFNHNTIPFVETEEQAHKVLQQISESFQDTGE
RPLVFYTIVNVDIRKIISKSVGINYNFLDQFVAPLEKVLGVPSKPEKHRTHSIHETTYDI
RIEAVNYALANDDGSNLKDYDEADIILTGVSRSGKTPTSLYLALQYGIKAANYPFTEEDM
GDMLKLPPALRRFKHKLFGLTIAADRLHQIRSERRANSKYASLPQCRMELREVENLYRKE
KIPFLNSTKYSIEEISAKILAETGLKRRKY