Protein Info for MIT1002_01807 in Alteromonas macleodii MIT1002

Annotation: Toxin RatA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF10604: Polyketide_cyc2" amino acids 12 to 148 (137 residues), 36.3 bits, see alignment E=6.3e-13 PF03364: Polyketide_cyc" amino acids 21 to 146 (126 residues), 126.1 bits, see alignment E=1e-40

Best Hits

Swiss-Prot: 63% identical to RATA_VIBCH: Ribosome association toxin RatA (ratA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 96% identity to amc:MADE_01810)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>MIT1002_01807 Toxin RatA (Alteromonas macleodii MIT1002)
MRPRVLIVVESMPSIHRSALVAHSAEAMFNLVNDVASYPEFLPGCTDSKILDTSAQSMKA
SLLVAKAGIKQWFTTHNVLEPGKSIQMQLVDGPFRSLTGGWTFSALSEEACKIELNLEFE
FSNKLAEMAFGKVFNSLASSMVAAFTDRARSVYA