Protein Info for MIT1002_01793 in Alteromonas macleodii MIT1002

Annotation: ribosomal protein S12 methylthiotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 27 to 649 (623 residues), 870.4 bits, see alignment E=2.5e-266 PF08497: Radical_SAM_N" amino acids 27 to 384 (358 residues), 471.6 bits, see alignment E=1.5e-145 PF04055: Radical_SAM" amino acids 385 to 588 (204 residues), 48.1 bits, see alignment E=2.3e-16 PF11842: DUF3362" amino acids 599 to 699 (101 residues), 133.4 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 72% identical to YGIQ_SALTI: UPF0313 protein YgiQ (ygiQ) from Salmonella typhi

KEGG orthology group: None (inferred from 92% identity to amc:MADE_01783)

Predicted SEED Role

"Probable Fe-S oxidoreductase family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (780 amino acids)

>MIT1002_01793 ribosomal protein S12 methylthiotransferase (Alteromonas macleodii MIT1002)
MQATIKADRGLFSYPKYWPHCLGTAPFLPMSKEEMDALGWDSCDVILVTGDAYVDHPSFG
MAVIGRVLEAHGFRVGIISQPDWTSKDDFMKLGKPNLYFGVTAGNMDSMINRYTSDKKLR
HDDAYTPGNVGGKRPDRAVTVYSQRCREAFKGVPVIVGGIEASLRRIAHYDYWSEKVRRS
VLFDSKADMLFFGNAERPLVEVTHRLAAGEDIADLRDIRGTAIIVKEALPEWQGVDSTSL
DRPGKIDAIPSPYQMEPECDSQDKDAKSSEAPEAAPIVIQPAQKEKEKRKPWENVYVKLP
AYETVKDNKVLYAHTSRILHQETNPGCARALMQRHGDRHIWINPPAMPLETEEMDAVFDL
PYQRVPHPVYGDAKIPAYDMIRFSINIMRGCYGGCTFCSITEHEGRIIQSRSEDSIIREI
EQIRDTVPGFTGVISDLGGPTANMYRLRCKSPKAEATCRRPSCVYPSICAHMDTDHKPTI
DLYRRARELPGIKKILIASGVRYDLAVEDPEYVKELALHHVGGYLKIAPEHTEDGPLSKM
MKPGMGSYYRFKELFDKYSQEAGKKQYLIPYFIASHPGTTDEDMLSLAIWLKENKFKLDQ
VQNFYPSPMATATTMYHTEVNSLRKVTKDSEEVPSAKGEIHRRLHKAMLRYHDPKNFAQI
REALKRMGREDLIGRGPQHLVPPETADEKRQKAQKGRRGERALTKHTGLPPTFQGKSSKG
GNGVNKSRRSSNANKQGHGSTAQQRNDTGGNKNRGNASKGNNSSGNSRGRTQKQPSMHKR