Protein Info for MIT1002_01785 in Alteromonas macleodii MIT1002

Annotation: NADH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 516 (516 residues), 765.7 bits, see alignment E=1e-234 PF13192: Thioredoxin_3" amino acids 122 to 198 (77 residues), 45.5 bits, see alignment E=2.8e-15 PF01134: GIDA" amino acids 217 to 266 (50 residues), 24.3 bits, see alignment 7.1e-09 PF00890: FAD_binding_2" amino acids 217 to 249 (33 residues), 20.4 bits, see alignment (E = 1.2e-07) PF07992: Pyr_redox_2" amino acids 217 to 503 (287 residues), 158.1 bits, see alignment E=1.5e-49 PF13738: Pyr_redox_3" amino acids 264 to 486 (223 residues), 65.4 bits, see alignment E=2.5e-21 PF00070: Pyr_redox" amino acids 357 to 429 (73 residues), 45.3 bits, see alignment E=4.6e-15

Best Hits

Swiss-Prot: 49% identical to AHPF_PSEAE: Alkyl hydroperoxide reductase subunit F (ahpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 97% identity to amc:MADE_01775)

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>MIT1002_01785 NADH dehydrogenase (Alteromonas macleodii MIT1002)
MLTKEILQALKSYAESMQKNVTFVVQTGEHSKREELVTFLSDIASVSEKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKSMVKAVNEP
LNFEVFISLSCHNCPEVVQALNQFALINPNIKTEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSARKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLIDQAQKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEVHTRELAGVFVQIGLVPNSQFMKGTVDMTQYGEIIVDTKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEQESEAA