Protein Info for MIT1002_01738 in Alteromonas macleodii MIT1002

Annotation: Thymidylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00041: dTMP kinase
  • amino acids 2 to 196 (195 residues), 195.2 bits, E=4.8e-62
• PF02223: Thymidylate_kin
  • amino acids 8 to 196 (189 residues), 173 bits, E=2.7e-55

Best Hits

Swiss-Prot: 88% identical to KTHY_ALTMD: Thymidylate kinase (tmk) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 88% identity to amc:MADE_02330)

MetaCyc: 52% identical to Tmk (Escherichia coli K-12 substr. MG1655)
T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.12, 2.7.4.13, 2.7.4.9]

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.9

Protein Sequence (224 amino acids)

>MIT1002_01738 Thymidylate kinase (Alteromonas macleodii MIT1002)
MRGKFIVVEGLEGAGKSSVIGLIVQALKGAGKRVEQTREPGGTPMAEAIRECVKHDWDET
VSEETELLLMYAARVQLLTNKILPSLDAGAWVVGDRHDLSSQAYQGGGRGVSEKTMTAIS
NIALKGFKPDLTLYLDVEPAVGLERARGRGELDRIEQAGLAFFERTRAKYLSLAKQDESI
VVVSAMQPMEKVHQDVIAIINDYVTNTSSESSNIARNESQQGKG