Protein Info for MIT1002_01727 in Alteromonas macleodii MIT1002

Annotation: Maf-like protein YceF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00172: septum formation protein Maf
  • amino acids 3 to 192 (190 residues), 155 bits, E=7.9e-50
• PF02545: Maf
  • amino acids 4 to 194 (191 residues), 169.3 bits, E=4e-54

Best Hits

Swiss-Prot: 48% identical to NTPPB_ALCBS: 7-methyl-GTP pyrophosphatase (ABO_1064) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: None (inferred from 82% identity to amc:MADE_02337)

MetaCyc: 46% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Protein Sequence (206 amino acids)

>MIT1002_01727 Maf-like protein YceF (Alteromonas macleodii MIT1002)
MASLVLASSSQYRKMLLANIGIQVDTHAPDIDETPFANESPTALSLRLAEQKAHKVAAEL
EKVNNDTIIIGSDQVALVQTDAGPQLLGKPGTFENAVNQLMACQGKQVSFYTALCLHQPS
ANKTITQVDETRVFFRHNSETAIRAYVDKEQPLDCAGSFKSEGLGVLLFDKIESRDPNSL
IGLPIMLLNELLSAHFDVDLLAMAAQ