Protein Info for MIT1002_01719 in Alteromonas macleodii MIT1002

Annotation: (S)-2-haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00702: Hydrolase" amino acids 54 to 237 (184 residues), 56 bits, see alignment E=7.2e-19 TIGR01428: haloacid dehalogenase, type II" amino acids 54 to 248 (195 residues), 161.4 bits, see alignment E=2.7e-51 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 56 to 235 (180 residues), 48.9 bits, see alignment E=8.8e-17 PF13419: HAD_2" amino acids 141 to 241 (101 residues), 53.8 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 79% identity to alt:ambt_10045)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.8.1.2

Use Curated BLAST to search for 3.1.3.- or 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>MIT1002_01719 (S)-2-haloacid dehalogenase (Alteromonas macleodii MIT1002)
MARSPSSLLSRLCCATAVGISLLSSPVFAQTDTRGAAQPDKNTAMSARELRAPKVIFFDV
NETLLDLTAMRSSVGEALGGRDDLLPLWFSTMLHHSLVDSTTGRFHTFGEIGVASLLMVA
EIEGIELTKAQAKTAIVTPLRSLPPHPDVRDGLQALKNKGYKLVSLTNSSNQGVYTQFKN
ADLLSYFDERLSVEDINLYKPDTRTYEWAIEKMSIAAEDAMLVAAHGWDIAGAKQAGWQA
AFIARPGKVLYPLAIAPDTVVSGLDELVSQLPDAK