Protein Info for MIT1002_01718 in Alteromonas macleodii MIT1002

Annotation: putative acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00583: Acetyltransf_1" amino acids 26 to 129 (104 residues), 52.4 bits, see alignment E=9.3e-18 PF13673: Acetyltransf_10" amino acids 36 to 148 (113 residues), 59.7 bits, see alignment E=4.5e-20 PF13508: Acetyltransf_7" amino acids 49 to 130 (82 residues), 41.7 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 44% identical to ELAA_SHIFL: Protein ElaA (elaA) from Shigella flexneri

KEGG orthology group: K02348, ElaA protein (inferred from 91% identity to amc:MADE_02345)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>MIT1002_01718 putative acyltransferase (Alteromonas macleodii MIT1002)
MVSWQSLTFNELTNHQLFDLLKLRVDVFVVEQNCAYPELDEKDRHPKTHHLMGFQDNKLV
ACARLLGEGVSYPSVSIGRVATSEAFRGKGAGRALMREAIDHCEALWPGCDIEIGAQEYL
KRFYEGFGFEATSTMYLEDDIPHIDMKRAGTATA