Protein Info for MIT1002_01698 in Alteromonas macleodii MIT1002
Annotation: Lipoprotein-releasing system ATP-binding protein LolD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to LOLD_VIBCH: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 90% identity to amc:MADE_02358)MetaCyc: 60% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"Lipoprotein releasing system ATP-binding protein LolD"
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (3/7 steps found)
Isozymes
Compare fitness of predicted isozymes for: 3.6.3.-
Use Curated BLAST to search for 3.6.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (236 amino acids)
>MIT1002_01698 Lipoprotein-releasing system ATP-binding protein LolD (Alteromonas macleodii MIT1002) MQDVLICRNINKTYQDGSNATPVLHDVSLSIKAGEHVAILGSSGSGKSTLLHILGGLDKP SSGEVEFNGKSLGQLSGNALAKLRNDEMGFIYQFHHLLGEFTALENVAMPLRIRGLSTKL AHGKAREMLDEVGLSHRVDHLPSTMSGGERQRVAIARALVTEPSVVLADEPTGNLDDSTG EQIYKLLTSLSDKKRTAFVVVTHDITLAGKMDRVLKIKDGRLASDTLFKENQDARL