Protein Info for MIT1002_01688 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA large subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 5 to 68 (64 residues), 75.6 bits, E=4.4e-25
• PF10672: Methyltrans_SAM
  • amino acids 170 to 340 (171 residues), 94 bits, E=1.9e-30
• PF03602: Cons_hypoth95
  • amino acids 216 to 301 (86 residues), 38.6 bits, E=1.9e-13

Best Hits

Swiss-Prot: 94% identical to RLMI_ALTMD: Ribosomal RNA large subunit methyltransferase I (rlmI) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 94% identity to amc:MADE_02391)

MetaCyc: 54% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Protein Sequence (397 amino acids)

>MIT1002_01688 Ribosomal RNA large subunit methyltransferase I (Alteromonas macleodii MIT1002)
MSAQVILQPSRDKSLRRKHPWVFESAVAELKGRARVGDTVDVFDSEGDWLGRGAYSPNSK
IRVRMWTFKKDESIDNGFFLRRLETALALRKRLFDPNKTNAFRWIASESDGLPGITIDLY
DNVAVLQLLSAGGEKHRDKIVWAITKLMPNVHIYERSDVDVRKKEGLEPVTGVLHGEPPM
QVTVKENGINIVVDIENGHKTGFYLDQRDSRAAAAHYAKDADVLNCFSYTGTFSCYALAG
GAKSVTNVDVSQPALDLAKHHVAINGLDENKANYVNQDVFKALREYHEQGKQFDMVILDP
PKFVDSKATLNRAARGYKDINMYGIHAVKSGGLLLTFSCSGLMPADLFQKVVADAALDAG
RTIKIIARLNQASDHPIIGSYPEGYYLKGLVCEVTDD