Protein Info for MIT1002_01659 in Alteromonas macleodii MIT1002

Annotation: L-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 368 to 394 (27 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 379 (352 residues), 157.8 bits, see alignment E=3.5e-50 PF00083: Sugar_tr" amino acids 77 to 197 (121 residues), 35.9 bits, see alignment E=4.4e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to amc:MADE_02423)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>MIT1002_01659 L-galactonate transporter (Alteromonas macleodii MIT1002)
MAHTHVEGIPAAEAGASRSYRNYVLFILTLVYAFNFIDRQIIGILSPFIKADLGLDDAQL
GWLKGIYFALLYTVMGIPIAWLADRYSRVNIIAISLTLWSGFTAASGLAANYMQLAIARI
GVGIGEAGGSPPSHSIISDLFPKEKRAGALAIYSLGIPFGVMLAFFASAFFLQGGSADWR
TVMYSVGIPGVLLAILLKLTIKEPARTVSLPSADDANKPSVKSSLKMLLKIPTWWGMALG
ISFGSFGNYAISTWVIDYYVRAFAGLDITQLLIVFGIINGTAYALGVWLGGYIADRWGKH
NKKAYALLPAIALIIGVPAFYASLQVQDLWLSVGLMALLLFTSGSYLGPSFAMAQTLAPI
NVRAMSTALFFFVLNIIALGGGPTLTGIISQALVPSLGETEALRQALIYLVVPYALSIAV
FLWTSTKIVKDWEMAEARGL